Mouse Monoclonal beta-Catenin Antibody (12F7)
Applications | FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Chicken, Primate |
Conjugation | Unconjugated |
Mouse Monoclonal beta-Catenin Antibody (12F7)
Applications | FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Chicken, Primate |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Chicken, Rat, Xenopus, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Rabbit polyclonal anti-Gli-3 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Xenopus, Dog, Chimpanzee, Chicken, Quail |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
Rabbit Polyclonal Anti-SHH Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Chicken |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT |
WNT7A Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Chimpanzee, Chicken, Dog, Xenopus, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon, Hamster, Horse, Orang-Utan, Guinea Pig |
Conjugation | Unconjugated |
Immunogen | WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%). |
WNT11 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Chicken, Dog, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon, Hamster, Horse |
Conjugation | Unconjugated |
Immunogen | WNT11 antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT11. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Rabbit, Pig, Turkey, Chicken, Platypus (100%); Opossum, Stickleback (87%); Xenopus, Zebrafish (80%). |
beta Catenin (CTNNB1) mouse monoclonal antibody, clone IMD-110, Purified
Applications | IF, IHC, WB |
Reactivities | Chicken, Human, Rat |
Conjugation | Unconjugated |