PIP4K2A mouse monoclonal antibody, clone OTI3A9 (formerly 3A9)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PIP4K2A mouse monoclonal antibody, clone OTI3A9 (formerly 3A9)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal Anti-PIP4K2A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIP4K2A antibody: synthetic peptide directed towards the N terminal of human PIP4K2A. Synthetic peptide located within the following region: IDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMH |
Rabbit polyclonal Anti-PIP4K2A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIP4K2A antibody: synthetic peptide directed towards the middle region of human PIP4K2A. Synthetic peptide located within the following region: EQEEVECEENDGEEEGESDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNI |