Germany
Japan
United Kingdom
China
Adaptive Immunity
View as table Download
Rabbit polyclonal Anti-CHST13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHST13 antibody: synthetic peptide directed towards the N terminal of human CHST13. Synthetic peptide located within the following region: ALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVHRQRRDLLNSACSRHSRR |
Rabbit polyclonal Anti-CHST13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHST13 antibody: synthetic peptide directed towards the C terminal of human CHST13. Synthetic peptide located within the following region: CHPCRLRYDVVGKFETLAEDAAFVLGLAGASDLSFPGPPRPRGAAASRDL |
Rabbit Polyclonal Anti-Chst11 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Chst11 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Chst11. Synthetic peptide located within the following region: RMVLATCFGSFILVIFYFQSMLHPVMRRNPFGVDICCRKGSRSPLQELYN |
Rabbit Polyclonal Anti-Chst11 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Chst11 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDS |
Active filters
Category
-
Antibodies
- Primary Antibodies
Families
- Transmembrane
Pathways
- Sulfur metabolism