Adaptive Immunity

Jump to Filters
View as table Download
MMP19 Rabbit Polyclonal Antibody
TA330243

USD 539.00

5 Days

Rabbit Polyclonal Anti-MMP19 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP19 antibody: synthetic peptide directed towards the N terminal of human MMP19. Synthetic peptide located within the following region: ALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWR
MMP19 Rabbit Polyclonal Antibody
TA330244

USD 485.00

5 Days

Rabbit Polyclonal Anti-MMP19 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP19 antibody: synthetic peptide directed towards the C terminal of human MMP19. Synthetic peptide located within the following region: IHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGS
MMP19 Rabbit Polyclonal Antibody
TA311663

USD 380.00

In Stock

Rabbit polyclonal anti-MMP-19 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP-19.
MMP19 Rabbit Polyclonal Antibody
TA323013

USD 380.00

In Stock

Anti-MMP19 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 494-508 amino acids of Human matrix metallopeptidase 19
MMP19 Rabbit Polyclonal Antibody
TA347434

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-MMP19 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP19 Antibody: A synthesized peptide derived from human MMP19
MMP19 Rabbit Polyclonal Antibody
TA354304

USD 425.00

5 Days

Rabbit anti MMP-19 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated