Germany
Japan
United Kingdom
China
Adaptive Immunity
View as table Download
Rabbit polyclonal anti-EFEMP1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EFEMP1. |
Rabbit Polyclonal Anti-EFEMP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1. Synthetic peptide located within the following region: NENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSV |
Rabbit Polyclonal Anti-EFEMP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1. Synthetic peptide located within the following region: GNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSS |
Rabbit Polyclonal Anti-EFEMP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1. Synthetic peptide located within the following region: KYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNENGEFYLRQTSPV |
Active filters
Target Symbol
- EFEMP1
Isotypes
- IgG
Families
- Secreted Protein