Adaptive Immunity

Jump to Filters
View as table Download
NR2F6 Rabbit Polyclonal Antibody
TA311673

USD 380.00

In Stock

Rabbit polyclonal anti-NR2F6 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human NR2F6.
NR2F6 Rabbit Polyclonal Antibody
TA338164

USD 539.00

5 Days

Rabbit Polyclonal Anti-NR2F6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6. Synthetic peptide located within the following region: AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV
NR2F6 Rabbit Polyclonal Antibody
TA330216

USD 539.00

5 Days

Rabbit Polyclonal Anti-NR2F6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6. Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP
NR2F6 Rabbit Polyclonal Antibody
TA330217

USD 485.00

5 Days

Rabbit Polyclonal Anti-NR2F6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6. Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP
NR2F6 Rabbit Polyclonal Antibody
TA332066

USD 485.00

5 Days

Rabbit Polyclonal Anti-NR2F6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NR2F6 Antibody: synthetic peptide directed towards the middle region of human NR2F6. Synthetic peptide located within the following region: GLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTP