Rabbit Polyclonal Anti-NR3C2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR3C2 antibody: synthetic peptide directed towards the middle region of human NR3C2. Synthetic peptide located within the following region: RRKNCPACRLQKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPP |
Rabbit Polyclonal anti-NR3C2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR3C2 antibody: synthetic peptide directed towards the N terminal of human NR3C2. Synthetic peptide located within the following region: METKGYHSLPEGLDMERRWGQVSQAVERSSLGPTERTDENNYMEIVNVSC |
Rabbit Polyclonal Anti-NR3C2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR3C2 antibody: synthetic peptide directed towards the C terminal of human NR3C2. Synthetic peptide located within the following region: VSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK |
Germany
Japan
United Kingdom
China
