Adaptive Immunity

Jump to Filters
View as table Download
Gelsolin (GSN) Rabbit Polyclonal Antibody
TA323717

USD 380.00

In Stock

Anti-GSN Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 768-782 amino acids of Human gelsolin
Gelsolin (GSN) Rabbit Polyclonal Antibody
TA323718

USD 380.00

In Stock

Anti-GSN Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 768-782 amino acids of Human gelsolin
Gelsolin (GSN) Rabbit Polyclonal Antibody
TA336242

USD 539.00

5 Days

Rabbit Polyclonal Anti-GSN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GSN Antibody: synthetic peptide directed towards the C terminal of human GSN. Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN
Gelsolin (GSN) Goat Polyclonal Antibody
TA303164

USD 520.00

5 Days

Goat Polyclonal Antibody against GSN

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-PRLKDKKMDAHP, from the internal region of the protein sequence according to NP_000168.1; NP_937895.1.
Gelsolin (GSN) Rabbit Polyclonal Antibody
TA327454

USD 365.00

3 Weeks

GSN Rabbit Polyclonal Antibody

Applications WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human GSN
Gelsolin (GSN) Mouse Monoclonal Antibody [Clone ID: GEL-42]
AM20623PU-N

USD 560.00

2 Weeks

Gelsolin (GSN) mouse monoclonal antibody, clone GEL-42, Purified

Applications IHC, WB
Reactivities Human, Rabbit
Conjugation Unconjugated