Adaptive Immunity

Jump to Filters
View as table Download
LIPC (Center) Rabbit Polyclonal Antibody
AP52492PU-N

USD 580.00

2 Weeks

LIPC (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 310-338 amino acids from the Central region of Human LIPC / Hepatic lipase
LIPC (N-term) Rabbit Polyclonal Antibody
AP52493PU-N

USD 580.00

2 Weeks

LIPC (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 16-44 amino acids from the N-terminal region of Human LIPC / Hepatic lipase
LIPC Rabbit Polyclonal Antibody
TA327045

USD 365.00

In Stock

Rabbit anti-LIPC Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human LIPC
LIPC Rabbit Polyclonal Antibody
TA343317

USD 539.00

5 Days

Rabbit Polyclonal Anti-LIPC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIPC antibody is: synthetic peptide directed towards the C-terminal region of LIPC. Synthetic peptide located within the following region: LKTIRVKAGETQQRMTFCSENTDDLLLRPTQEKIFVKCEIKSKTSKRKIR