Adaptive Immunity

View as table Download

ARAF mouse monoclonal antibody, clone OTI2G9 (formerly 2G9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ARAF mouse monoclonal antibody, clone OTI2G9 (formerly 2G9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ARAF mouse monoclonal antibody, clone OTI2G9 (formerly 2G9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ARAF mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ARAF mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) ARAF mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ARAF mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) Purified ARAF mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Purified ARAF mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal antibody to ARAF (v-raf murine sarcoma 3611 viral oncogene homolog)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Pig, Rat, Zebrafish, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 371 and 554 of A-RAF (Uniprot ID#P10398)

ARAF mouse monoclonal antibody, clone OTI2F8 (formerly 2F8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ARAF mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit polyclonal anti-A-RAF antibody

Applications WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human A-RAF.

Rabbit Polyclonal Anti-ARAF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARAF antibody: synthetic peptide directed towards the middle region of human ARAF. Synthetic peptide located within the following region: PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW