Anti-MAP3K14 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human mitogen-activated protein kinase kinase kinase 14 |
Anti-MAP3K14 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human mitogen-activated protein kinase kinase kinase 14 |
Anti-MAP3K14 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human mitogen-activated protein kinase kinase kinase 14 |
NFkB Inducing Kinase NIK (MAP3K14) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the center region of human NIK. |
Rabbit Polyclonal NIK Antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | NIK antibody was raised against a 17 amino acid peptide near the carboxy terminus of human NIK. The immunogen is located within the last 50 amino acids of NIK. |
Rabbit Polyclonal Anti-MAP3K14 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAP3K14 antibody: synthetic peptide directed towards the N terminal of human MAP3K14. Synthetic peptide located within the following region: SEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN |