Adaptive Immunity

Jump to Filters
View as table Download
HSPA4 Rabbit Polyclonal Antibody
TA349855

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-HSPA4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human HSPA4
HSPA4 Mouse Monoclonal Antibody [Clone ID: W27]
TA327943

USD 540.00

5 Days

Mouse Monoclonal anti-Hsp70 Antibody

Applications FC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
HSPA4 Rabbit Polyclonal Antibody
TA339252

USD 539.00

5 Days

Rabbit Polyclonal Anti-HSPA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA4 antibody: synthetic peptide directed towards the middle region of human HSPA4. Synthetic peptide located within the following region: PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK
HSPA4 Rabbit Polyclonal Antibody
TA339251

USD 539.00

5 Days

Rabbit Polyclonal Anti-HSPA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPA4 antibody: synthetic peptide directed towards the N terminal of human HSPA4. Synthetic peptide located within the following region: PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS