Rabbit polyclonal antibody to HLA-DMA (major histocompatibility complex, class II, DM alpha)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 52 and 245 of HLA-DMA |
Rabbit Polyclonal Anti-HLA-DMA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-DMA antibody: synthetic peptide directed towards the N terminal of human HLA-DMA. Synthetic peptide located within the following region: GLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEW |
Germany
Japan
United Kingdom
China
