Adaptive Immunity

Jump to Filters
View as table Download
ID2 Rabbit Polyclonal Antibody
TA350018

USD 380.00

In Stock

Rabbit Polyclonal Anti-ID2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ID2
ID2 Rabbit Polyclonal Antibody
TA351273

USD 380.00

In Stock

Rabbit Polyclonal Anti-ID2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ID2
ID2 Rabbit Polyclonal Antibody
TA330145

USD 539.00

5 Days

Rabbit Polyclonal Anti-ID2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ID2 antibody: synthetic peptide directed towards the middle region of human ID2. Synthetic peptide located within the following region: TIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALC