Adaptive Immunity

Jump to Filters
View as table Download
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA334657

USD 539.00

5 Days

Rabbit Polyclonal Anti-SHH Antibody

Applications IHC, WB
Reactivities Human, Mouse, Chicken
Conjugation Unconjugated
Immunogen The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT
beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: IMD-110]
AM20692PU-N

USD 560.00

2 Weeks

beta Catenin (CTNNB1) mouse monoclonal antibody, clone IMD-110, Purified

Applications IF, IHC, WB
Reactivities Chicken, Human, Rat
Conjugation Unconjugated