Adaptive Immunity

View as table Download

Rabbit Polyclonal Anti-GSN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GSN Antibody: synthetic peptide directed towards the C terminal of human GSN. Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN

Goat Polyclonal Antibody against GSN

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-PRLKDKKMDAHP, from the internal region of the protein sequence according to NP_000168.1; NP_937895.1.

GSN Rabbit Polyclonal Antibody

Applications WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human GSN

Gelsolin (GSN) mouse monoclonal antibody, clone GEL-42, Purified

Applications IHC, WB
Reactivities Human, Rabbit
Conjugation Unconjugated