Germany
Japan
United Kingdom
China
Adaptive Immunity
View as table Download
Rabbit Anti-Ribosomal S6 kinase 2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the C-terminal region conjugated to KLH |
Rabbit polyclonal anti-S6K-a2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human S6K-a2. |
Rabbit Polyclonal Anti-RPS6KA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RPS6KA2 Antibody: synthetic peptide directed towards the middle region of human RPS6KA2. Synthetic peptide located within the following region: LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR |
Active filters
Target Symbol
- RSK3
Antibody Hosts
- Rabbit
Pathways
- Progesterone-mediated oocyte maturation