Adaptive Immunity

Jump to Filters
View as table Download
MOS Rabbit Polyclonal Antibody
TA314212

USD 380.00

In Stock

Rabbit polyclonal anti-MOS antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MOS.
MOS Rabbit Polyclonal Antibody
TA342241

USD 539.00

5 Days

Rabbit polyclonal Anti-MOS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MOS antibody: synthetic peptide directed towards the middle region of human MOS. Synthetic peptide located within the following region: LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG
MOS Rabbit Polyclonal Antibody
TA347555

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-MOS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MOS Antibody: A synthesized peptide derived from human MOS