Adaptive Immunity

Jump to Filters
View as table Download
Apc7 (ANAPC7) Rabbit Polyclonal Antibody
TA319926

USD 570.00

5 Days

Rabbit Polyclonal APC7 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APC7 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human APC7.
Apc7 (ANAPC7) Rabbit Polyclonal Antibody
TA346133

USD 539.00

5 Days

Rabbit Polyclonal Anti-ANAPC7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7. Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS