Adaptive Immunity

Jump to Filters
View as table Download
Eph receptor A6 (EPHA6) (C-term) Rabbit Polyclonal Antibody
AP23642PU-N

USD 535.00

2 Weeks

Eph receptor A6 (EPHA6) (C-term) rabbit polyclonal antibody

Applications ELISA, IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen EPHA6 antibody was raised against synthetic peptide - KLH conjugated
Eph receptor A6 (EPHA6) Rabbit Polyclonal Antibody
TA316322

USD 380.00

4 Weeks

Rabbit polyclonal anti-EPHA6 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EPHA6.
Eph receptor A6 (EPHA6) Rabbit Polyclonal Antibody
TA338322

USD 539.00

5 Days

Rabbit Polyclonal Anti-EPHA6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPHA6 antibody is: synthetic peptide directed towards the N-terminal region of Human EPHA6. Synthetic peptide located within the following region: DTIPRVDSSSLVEVRGSCVKSAEERDTPKLYCGADGDWLVPLGRCICSTG