Goat Polyclonal Antibody against EBAG9
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KEAQRLMKKEQN, from the C Terminus of the protein sequence according to NP_004206.1. |
Rabbit Polyclonal Anti-EBAG9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EBAG9 antibody: synthetic peptide directed towards the C terminal of human EBAG9. Synthetic peptide located within the following region: DLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEA |
Rabbit anti RCAS1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human RCAS1 protein, this sequence is identical to mouse, bovine, dog. |
EBAG9 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human EBAG9 |
Germany
Japan
United Kingdom
China