Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Goat Polyclonal Anti-Rab11 Antibody
| Applications | IHC, WB |
| Reactivities | Canine, Human, Monkey, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptides derived from within residues 110 aa to the C-terminus of mouse Rab11a, Rab11b and Rab11c (Rab25) produced in E. coli. |
Rabbit Polyclonal Anti-RAB11B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB11B antibody: synthetic peptide directed towards the C terminal of human RAB11B. Synthetic peptide located within the following region: IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV |
Goat Polyclonal Antibody against RAB11A / YL8
| Applications | WB |
| Reactivities | Mouse (Expected from sequence similarity: Human, Rat, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence TENKPKVQCCQNI, from the C Terminus of the protein sequence according to NP_004654. |
Germany
Japan
United Kingdom
China
