Endosomal Marker Antibodies

Jump to Filters
View as table Download
Caveolin 1 (CAV1) Mouse Monoclonal Antibody [Clone ID: OTI2C4]
TA812677

USD 447.00

In Stock

CAV1 mouse monoclonal antibody,clone OTI2C4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Caveolin 1 (CAV1) Mouse Monoclonal Antibody [Clone ID: OTI2C4]
CF812677

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) CAV1 mouse monoclonal antibody,clone OTI2C4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Caveolin 1 (CAV1) Mouse Monoclonal Antibody [Clone ID: OTI2C4]
TA812677S

USD 200.00

In Stock

CAV1 mouse monoclonal antibody,clone OTI2C4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Caveolin 1 (CAV1) Mouse Monoclonal Antibody [Clone ID: 7C8]
TA301445

USD 605.00

2 Weeks

Mouse Monoclonal Antibody against Caveolin 1 (7C8)

Applications FC, ICC/IF, IHC, Immunoblotting, IP, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Caveolin 1 (CAV1) Rabbit Polyclonal Antibody
TA350951

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-CAV1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CAV1
Caveolin 1 (CAV1) Rabbit Polyclonal Antibody
TA330401

USD 485.00

5 Days

Rabbit Polyclonal Anti-CAV1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAV1 antibody: synthetic peptide directed towards the N terminal of human CAV1. Synthetic peptide located within the following region: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEID
Caveolin 1 (CAV1) (C-term) Rabbit Polyclonal Antibody
AP31042PU-N

USD 575.00

2 Weeks

Caveolin 1 (CAV1) (C-term) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide from C-terminal domain of human caveolin-1