Endosomal Marker Antibodies

View as table Download

Rabbit anti-HLA-A Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human HLA-A

Rabbit Polyclonal Anti-HLA-A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-A antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-A. Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ

HLA-A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human HLA-A