Endosomal Marker Antibodies

Jump to Filters
View as table Download
PGRMC1 Rabbit Polyclonal Antibody
TA341853

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-PGRMC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGRMC1 antibody: synthetic peptide directed towards the N terminal of human PGRMC1. Synthetic peptide located within the following region: MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ
PGRMC1 Rabbit Polyclonal Antibody
TA332794

USD 365.00

3 Weeks

Rabbit anti-PGRMC1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PGRMC1