Endosomal Marker Antibodies

Jump to Filters
View as table Download
RHBDF1 Rabbit Polyclonal Antibody
TA338604

USD 539.00

5 Days

Rabbit Polyclonal Anti-RHBDF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RHBDF1 antibody: synthetic peptide directed towards the N terminal of human RHBDF1. Synthetic peptide located within the following region: KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR
RHBDF1 Rabbit Polyclonal Antibody
TA380900

USD 365.00

3 Weeks

RHBDF1 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 200-400 of human RHBDF1 (NP_071895.3).
Modifications Unmodified