Endosomal Marker Antibodies

Jump to Filters
View as table Download
RAB11FIP1 Rabbit Polyclonal Antibody
TA590445

USD 482.00

In Stock

Rabbit Polyclonal FIP1/RCP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody was made against a protein fragment from the N Terminus Region
RAB11FIP1 Rabbit Polyclonal Antibody
TA337977

USD 539.00

5 Days

Rabbit Polyclonal Anti-RAB11FIP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB11FIP1 antibody is: synthetic peptide directed towards the N-terminal region of Human RAB11FIP1. Synthetic peptide located within the following region: ALLGLDKFLGRAEVDLRDLHRDQGRRKTQWYKLKSKPGKKDKERGEIEVD
RAB11FIP1 Rabbit Polyclonal Antibody
TA380605

USD 365.00

3 Weeks

RAB11FIP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 330-540 of human RAB11FIP1 (NP_079427.4).
Modifications Unmodified