Endosomal Marker Antibodies

Jump to Filters
View as table Download
RAB11FIP5 Rabbit Polyclonal Antibody
TA380607

USD 365.00

3 Weeks

RAB11FIP5 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RAB11FIP5
Modifications Unmodified
RAB11FIP5 Rabbit Polyclonal Antibody
TA333818

USD 539.00

5 Days

Rabbit Polyclonal Anti-RAB11FIP5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RAB11FIP5 Antibody: synthetic peptide directed towards the N terminal of human RAB11FIP5. Synthetic peptide located within the following region: MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQV