Cytoskeleton Marker Antibodies

View as table Download

Rabbit Polyclonal Anti-DES Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DES antibody: synthetic peptide directed towards the N terminal of human DES. Synthetic peptide located within the following region: PLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTR

Rabbit Polyclonal Anti-Desmin Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Desmin Antibody: A synthesized peptide derived from human Desmin

Rabbit anti Desmin (pT76/77)Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus with a dual phosphorylated threonine (Thr76/Thr77) of human Desmin.

Rabbit anti Desmin (Paired T76/77) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus surrounding Threonine (Thr76/Thr77) without phosphorylation of human Desmin.