Cytoskeleton Marker Antibodies

Jump to Filters
View as table Download
PIK3CB Rabbit Polyclonal Antibody
TA351530

USD 380.00

In Stock

Rabbit Polyclonal Anti-PIK3CB Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIK3CB
PIK3CB Rabbit Polyclonal Antibody
TA329903

USD 485.00

5 Days

Rabbit Polyclonal Anti-PIK3CB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIK3CB antibody: synthetic peptide directed towards the C terminal of human PIK3CB. Synthetic peptide located within the following region: VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD
PI 3 Kinase p85 alpha (PIK3R1) (alpha/gamma/beta) Rabbit Polyclonal Antibody
AP09473PU-N

USD 405.00

2 Weeks

PI 3 Kinase p85 alpha (PIK3R1) (alpha/gamma/beta) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PI3K P85 alpha/gamma/beta around the phosphorylation site of Tyrosine 467/199/464 (L-Yp-E-E-Y).
PI 3 Kinase p85 alpha (PIK3R1) (alpha/gamma/beta) Rabbit Polyclonal Antibody
AP09473PU-S

USD 315.00

2 Weeks

PI 3 Kinase p85 alpha (PIK3R1) (alpha/gamma/beta) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PI3K P85 alpha/gamma/beta around the phosphorylation site of Tyrosine 467/199/464 (L-Yp-E-E-Y).
PIK3CB Rabbit Polyclonal Antibody
TA330901

USD 539.00

5 Days

Rabbit Polyclonal Anti-PIK3CB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PIK3CB antibody is: synthetic peptide directed towards the N-terminal region of Human PIK3CB. Synthetic peptide located within the following region: ENATALHVKFPENKKQPYYYPPFDKSRGGKKFLPVLKEILDRDPLSQLCE
PI 3 Kinase p85 beta (PIK3R2) Rabbit Polyclonal Antibody
TA360980

USD 539.00

5 Days

PIK3R2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PIK3R2