Germany
Japan
United Kingdom
China
Cytoskeleton Marker Antibodies
View as table Download
Rabbit Polyclonal Anti-PIP5K1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PIP5K1B antibody is: synthetic peptide directed towards the C-terminal region of Human PIP5K1B. Synthetic peptide located within the following region: VFKKIQALKASPSKKRCNSIAALKATSQEIVSSISQEWKDEKRDLLTEGQ |
Rabbit Polyclonal Anti-PIP4K2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PIP4K2B Antibody is: synthetic peptide directed towards the C-terminal region of Human PIP4K2B. Synthetic peptide located within the following region: DVYAMKSHESSPKKEVYFMAIIDILTPYDTKKKAAHAAKTVKHGAGAEIS |
Rabbit Polyclonal Anti-EGF Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF |
