Rabbit Polyclonal MAP2K1IP1/MAPKSP1 Antibody
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A genomic peptide made to an internal region of the human MAP2K1IP1 protein (within residues 20-180). [Swiss-Prot Q9UHA4] |
Rabbit Polyclonal antibody to MP1 (MAPK scaffold protein 1)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 124 of MP1 (Uniprot ID#Q9UHA4) |
Rabbit Polyclonal Anti-LAMTOR3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LAMTOR3 antibody is: synthetic peptide directed towards the N-terminal region of Human LAMTOR3. Synthetic peptide located within the following region: LPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSK |
Germany
Japan
United Kingdom
China
