MAP1D (METAP1D) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 309-335 amino acids from the N-terminal region of Human Methionine aminopeptidase 1D |
Rabbit Polyclonal Anti-METAP1D Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-METAP1D antibody is: synthetic peptide directed towards the N-terminal region of Human METAP1D. Synthetic peptide located within the following region: LNHIYLHKQSSSQQRRNFFFRRQRDISHSIVLPAAVSSAHPVPKHIKKPD |
Germany
Japan
United Kingdom
China