Cytoskeleton Marker Antibodies

View as table Download

Rabbit Polyclonal Anti-PIP5K1B Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PIP5K1B

Rabbit Polyclonal Anti-PIK3CB Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIK3CB

Rabbit Polyclonal Anti-PIP5K1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PIP5K1B antibody is: synthetic peptide directed towards the C-terminal region of Human PIP5K1B. Synthetic peptide located within the following region: VFKKIQALKASPSKKRCNSIAALKATSQEIVSSISQEWKDEKRDLLTEGQ

Rabbit Polyclonal Anti-PIK3CB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIK3CB antibody: synthetic peptide directed towards the C terminal of human PIK3CB. Synthetic peptide located within the following region: VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD

Rabbit Polyclonal Anti-PIP4K2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PIP4K2B Antibody is: synthetic peptide directed towards the C-terminal region of Human PIP4K2B. Synthetic peptide located within the following region: DVYAMKSHESSPKKEVYFMAIIDILTPYDTKKKAAHAAKTVKHGAGAEIS

PI 3 Kinase p85 alpha (PIK3R1) (alpha/gamma/beta) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PI3K P85 alpha/gamma/beta around the phosphorylation site of Tyrosine 467/199/464 (L-Yp-E-E-Y).

PI 3 Kinase p85 alpha (PIK3R1) (alpha/gamma/beta) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PI3K P85 alpha/gamma/beta around the phosphorylation site of Tyrosine 467/199/464 (L-Yp-E-E-Y).

Rabbit Polyclonal Anti-PIK3CB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PIK3CB antibody is: synthetic peptide directed towards the N-terminal region of Human PIK3CB. Synthetic peptide located within the following region: ENATALHVKFPENKKQPYYYPPFDKSRGGKKFLPVLKEILDRDPLSQLCE

PIP4K2B Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PIP4K2B

PIK3R2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PIK3R2