Rabbit Polyclonal Anti-PIK3CB Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PIK3CB |
Rabbit Polyclonal Anti-PIK3CB Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PIK3CB |
Rabbit Polyclonal Anti-PIK3CB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIK3CB antibody: synthetic peptide directed towards the C terminal of human PIK3CB. Synthetic peptide located within the following region: VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD |
USD 405.00
2 Weeks
PI 3 Kinase p85 alpha (PIK3R1) (alpha/gamma/beta) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PI3K P85 alpha/gamma/beta around the phosphorylation site of Tyrosine 467/199/464 (L-Yp-E-E-Y). |
USD 315.00
2 Weeks
PI 3 Kinase p85 alpha (PIK3R1) (alpha/gamma/beta) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PI3K P85 alpha/gamma/beta around the phosphorylation site of Tyrosine 467/199/464 (L-Yp-E-E-Y). |
Rabbit Polyclonal Anti-PIK3CB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PIK3CB antibody is: synthetic peptide directed towards the N-terminal region of Human PIK3CB. Synthetic peptide located within the following region: ENATALHVKFPENKKQPYYYPPFDKSRGGKKFLPVLKEILDRDPLSQLCE |
PIK3R2 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PIK3R2 |
USD 380.00
4 Weeks
Mouse Monoclonal PI3 Kinase p85 beta Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |