Cytoskeleton Marker Antibodies

Jump to Filters
View as table Download
ACTR8 Rabbit Polyclonal Antibody
TA333696

USD 539.00

5 Days

Rabbit Polyclonal Anti-ACTR8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTR8 Antibody is: synthetic peptide directed towards the N-terminal region of Human ACTR8. Synthetic peptide located within the following region: MTQAEKGDTENGKEKGGEKEKEQRGVKRPIVPALVPESLQEQIQSNFIIV
ACTR8 Rabbit Polyclonal Antibody
TA361686

USD 539.00

5 Days

ACTR8 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ACTR8