Germany
Japan
United Kingdom
China
Cytoskeleton Marker Antibodies
View as table Download
Rabbit Polyclonal Anti-ENO4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ENO4 Antibody is: synthetic peptide directed towards the N-terminal region of Human ENO4. Synthetic peptide located within the following region: FFASKVQEDKGRKELEKSLEYSTVPTPLPPVPPPPPPPPPTKKKGQKPGR |
Rabbit Polyclonal Anti-ENO4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ENO4 Antibody is: synthetic peptide directed towards the N-terminal region of Human ENO4. Synthetic peptide located within the following region: PPVPPPPPPPPPTKKKGQKPGRKDTITEKPIAPAEPVEPVLSGSMAIGAV |
