Cytoskeleton Marker Antibodies

View as table Download

PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived recombinant Human PDGF-BB.

PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived recombinant Human PDGF-BB.

Anti-PDGFB Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 101-115 amino acids of Human platelet-derived growth factor beta polypeptide

PDGF beta (PDGFB) (222-233) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Bovine, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide from C-Terminus of human PDGFB (NP_002599.1; NP_148937.1)

Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD

Rabbit anti-PDGFB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PDGFB