Cytoskeleton Marker Antibodies

Jump to Filters
View as table Download
ENO3 Rabbit Polyclonal Antibody
TA366025

USD 380.00

4 Weeks

ENO3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ENO3
ENO3 Rabbit Polyclonal Antibody
TA308243

USD 625.00

5 Days

Rabbit Polyclonal antibody to ENO3 (enolase 3 (beta, muscle))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 196 and 434 of ENO3 (Uniprot ID#P13929)
ENO3 Rabbit Polyclonal Antibody
TA346567

USD 485.00

5 Days

Rabbit Polyclonal Anti-ENO3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ENO3 antibody: synthetic peptide directed towards the N terminal of human ENO3. Synthetic peptide located within the following region: MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELR