Cytoskeleton Marker Antibodies

Jump to Filters
View as table Download
BAF53A (ACTL6A) Rabbit Polyclonal Antibody
TA313419

USD 380.00

In Stock

Rabbit polyclonal anti-ACL6A antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ACL6A.
BAF53A (ACTL6A) Rabbit Polyclonal Antibody
TA333971

USD 539.00

5 Days

Rabbit Polyclonal Anti-ACTL6A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTL6A Antibody: synthetic peptide directed towards the N terminal of human ACTL6A. Synthetic peptide located within the following region: VDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENMEA
BAF53A (ACTL6A) Rabbit Polyclonal Antibody
TA332659

USD 365.00

3 Weeks

Rabbit anti-ACTL6A Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ACTL6A
BAF53A (ACTL6A) Rabbit Polyclonal Antibody
TA345058

USD 539.00

5 Days

Rabbit Polyclonal Anti-ACTL6A Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTL6A antibody is: synthetic peptide directed towards the middle region of Human ACTL6A. Synthetic peptide located within the following region: TVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSV