Rabbit polyclonal anti-ACL6A antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ACL6A. |
Rabbit polyclonal anti-ACL6A antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ACL6A. |
Rabbit Polyclonal Anti-ACTL6A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ACTL6A Antibody: synthetic peptide directed towards the N terminal of human ACTL6A. Synthetic peptide located within the following region: VDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTYYIDTNALRVPRENMEA |
Rabbit anti-ACTL6A Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ACTL6A |
Rabbit Polyclonal Anti-ACTL6A Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ACTL6A antibody is: synthetic peptide directed towards the middle region of Human ACTL6A. Synthetic peptide located within the following region: TVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSV |