Germany
Japan
United Kingdom
China
Cytoskeleton Marker Antibodies
View as table Download
Rabbit Polyclonal Anti-TUBA3C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TUBA3C Antibody: synthetic peptide directed towards the N terminal of human TUBA3C. Synthetic peptide located within the following region: VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDL |
Rabbit Polyclonal Anti-RUVBL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RUVBL1 antibody: synthetic peptide directed towards the N terminal of human RUVBL1. Synthetic peptide located within the following region: KIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGV |
PAK1 pThr423/402/421 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PAK1 around the phosphorylation site of threonine 423 (R-S-TP-M-V). |
PAK1 pThr423/402/421 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PAK1 around the phosphorylation site of threonine 423 (R-S-TP-M-V). |
PAK1 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1around the phosphorylation site of threonine 423 (R-S-Tp-M-V). |
PAK1 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PAK1around the phosphorylation site of threonine 423 (R-S-Tp-M-V). |
PAK1 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 400-450 of Human PAK1. |
PAK1 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Alpha-tubulin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal Tubulin antibody was raised against a 16 amino acid peptide near the amino terminus of human Tubulin. |
Rabbit Polyclonal Anti-TUBA3C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TUBA3C Antibody: synthetic peptide directed towards the N terminal of human TUBA3C. Synthetic peptide located within the following region: QMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYR |
Rabbit Polyclonal Anti-Phospho-PAK3(Ser154) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-PAK3(Ser154) Antibody: A synthesized peptide derived from human PAK3 around the phosphorylation site of Sersine 154 |
| Modifications | Phospho-specific |
Active filters
Category
- Antibodies
Reactivities
- Human
Antibody Hosts
- Rabbit
Families
- Stem cell - Pluripotency
Filter by
Target Symbol
Applications
Isotypes
Clonalities
Conjugates
Modifications
Assay Types
Pathways
- Axon guidance (12)
- ErbB signaling pathway (12)
- Focal adhesion (12)
- Regulation of actin cytoskeleton (12)
- Renal cell carcinoma (12)
- T cell receptor signaling pathway (12)
- Chemokine signaling pathway (7)
- Epithelial cell signaling in Helicobacter pylori infection (7)
- Fc gamma R-mediated phagocytosis (7)
- MAPK signaling pathway (7)
- Natural killer cell mediated cytotoxicity (7)
- Gap junction (3)
- Pathogenic Escherichia coli infection (3)
- Wnt signaling pathway (2)