Cytoplasm Marker Antibodies

View as table Download

Rabbit Polyclonal Anti-TUBA3C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TUBA3C Antibody: synthetic peptide directed towards the N terminal of human TUBA3C. Synthetic peptide located within the following region: VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDL

Rabbit Polyclonal Alpha-tubulin Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal Tubulin antibody was raised against a 16 amino acid peptide near the amino terminus of human Tubulin.

Rabbit Polyclonal Anti-TUBA3C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TUBA3C Antibody: synthetic peptide directed towards the N terminal of human TUBA3C. Synthetic peptide located within the following region: QMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYR