Germany
Japan
United Kingdom
China
Cytoplasm Marker Antibodies
View as table Download
Mouse Monoclonal iNOS Antibody (4E5)
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
TA336918 is a replacement of AM06772PU-N.
NOS2 mouse monoclonal antibody, clone OTI1A1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NOS2 mouse monoclonal antibody, clone OTI11H3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NOS2 mouse monoclonal antibody, clone OTI3H7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NOS2 mouse monoclonal antibody, clone OTI1A1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NOS2 mouse monoclonal antibody, clone OTI11H3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NOS2 mouse monoclonal antibody, clone OTI3H7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
NOS2 mouse monoclonal antibody, clone OTI1A1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 509.00
2 Weeks
NOS2 mouse monoclonal antibody, clone OTI1A1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 509.00
2 Weeks
NOS2 mouse monoclonal antibody, clone OTI11H3, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 509.00
2 Weeks
NOS2 mouse monoclonal antibody, clone OTI11H3, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 509.00
2 Weeks
NOS2 mouse monoclonal antibody, clone OTI3H7, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 509.00
2 Weeks
NOS2 mouse monoclonal antibody, clone OTI3H7, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit Polyclonal Anti-ISYNA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ISYNA1 Antibody: synthetic peptide directed towards the N terminal of human ISYNA1. Synthetic peptide located within the following region: LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD |
Active filters
Reactivities
- Human
Applications
- WB
Families
- Druggable Genome
Pathways
- Metabolic pathways