Rabbit polyclonal anti-iNOS antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human iNOS. |
Rabbit polyclonal anti-iNOS antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human iNOS. |
Mouse Monoclonal iNOS Antibody (4E5)
Applications | ELISA, FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
NOS2 mouse monoclonal antibody, clone OTI1A1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
NOS2 mouse monoclonal antibody, clone OTI11H3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
NOS2 mouse monoclonal antibody, clone OTI3H7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NOS2 mouse monoclonal antibody, clone OTI1A1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NOS2 mouse monoclonal antibody, clone OTI11H3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NOS2 mouse monoclonal antibody, clone OTI3H7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
NOS2 mouse monoclonal antibody, clone OTI1A1, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
NOS2 mouse monoclonal antibody, clone OTI1A1, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
USD 509.00
2 Weeks
NOS2 mouse monoclonal antibody, clone OTI11H3, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
NOS2 mouse monoclonal antibody, clone OTI11H3, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
USD 509.00
2 Weeks
NOS2 mouse monoclonal antibody, clone OTI3H7, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
NOS2 mouse monoclonal antibody, clone OTI3H7, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit Polyclonal Anti-ISYNA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ISYNA1 Antibody: synthetic peptide directed towards the N terminal of human ISYNA1. Synthetic peptide located within the following region: LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD |