Germany
Japan
United Kingdom
China
Centrosome Marker Antibodies
View as table Download
Rabbit polyclonal Plk1 phospho T210 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-Polo-like Kinase pT210 Antibody was produced by repeated immunizations with a synthetic phospho peptide corresponding to aa 205-214 of Human Polo-like kinase 1 (Plk1) protein. |
Rabbit polyclonal CDK1/CDC2 (Thr14) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDK1/CDC2 around the phosphorylation site of threonine 14 (E-G-TP-Y-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CDK1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2. Synthetic peptide located within the following region: SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM |
Rabbit polyclonal anti-cdk2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Anti-cdk2 antbody was prepared from whole rabbit serum by repeated immunizations with a synthetic peptide corresponding to the C-terminus of the human cdk-2 protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Rabbit anti CDC2 (pY15) (CDK1) Polyclonal Antibody
| Applications | Dot, WB |
| Reactivities | Human, Chicken, Bovine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -GTYGV- with a phosphorylation site at Tyr15 of human CDC2 protein. This sequence is identical among human, mouse, rat, bovine and chicken species. |
Rabbit anti CDC2 (Paired Y15) (CDK1) Polyclonal Antibody
| Applications | Dot, WB |
| Reactivities | Human, Chicken, Bovine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -GTYGV- without a phosphorylation site at Tyr15 of human CDC2 protein. This sequence is identical among human, mouse, rat, bovine and chicken species. |
Active filters
Antibody Hosts
- Rabbit
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Protein Kinase
Filter by
Category
Reactivities
Clonalities
Modifications
Assay Types
Pathways
- Oocyte meiosis (40)
- Progesterone-mediated oocyte maturation (40)
- Cell cycle (31)
- Gap junction (26)
- p53 signaling pathway (24)
- Pathways in cancer (20)
- Prostate cancer (20)
- Acute myeloid leukemia (11)
- B cell receptor signaling pathway (11)
- Bladder cancer (11)
- Chemokine signaling pathway (11)
- Chronic myeloid leukemia (11)
- Colorectal cancer (11)
- Dorso-ventral axis formation (11)
- Endometrial cancer (11)
- ErbB signaling pathway (11)
- Fc epsilon RI signaling pathway (11)
- Fc gamma R-mediated phagocytosis (11)
- Focal adhesion (11)
- Glioma (11)
- GnRH signaling pathway (11)
- Insulin signaling pathway (11)
- Long-term depression (11)
- Long-term potentiation (11)
- MAPK signaling pathway (11)
- Melanogenesis (11)
- Melanoma (11)
- Natural killer cell mediated cytotoxicity (11)
- Neurotrophin signaling pathway (11)
- Non-small cell lung cancer (11)
- Pancreatic cancer (11)
- Prion diseases (11)
- Regulation of actin cytoskeleton (11)
- Renal cell carcinoma (11)
- T cell receptor signaling pathway (11)
- Thyroid cancer (11)
- Toll-like receptor signaling pathway (11)
- VEGF signaling pathway (11)
- Vascular smooth muscle contraction (11)
- Small cell lung cancer (9)