Marginal Zone B cell

Proteins (4)
Antibodies (2)
Jump to Filters
View as table Download
MS4A4A (N-term) Rabbit Polyclonal Antibody
AP52577PU-N

USD 580.00

2 Weeks

MS4A4A (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 40-68 amino acids from the N-terminal region of Human MS4A4A
MS4A4A Rabbit Polyclonal Antibody
TA344314

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-MS4A4A Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MS4A4A antibody: synthetic peptide directed towards the N terminal of human MS4A4A. Synthetic peptide located within the following region: MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL
MS4A4A (NM_024021) Human Over-expression Lysate
LC402965

USD 134.00

2 Weeks

MS4A4A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
MS4A4A (NM_148975) Human Over-expression Lysate
LC403453

USD 134.00

2 Weeks

MS4A4A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
MS4A4A (NM_148975) Human Over-expression Lysate
LY403453

USD 436.00

5 Days

Transient overexpression lysate of membrane-spanning 4-domains, subfamily A, member 4 (MS4A4A), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
MS4A4A (NM_024021) Human Over-expression Lysate
LY402965

USD 436.00

5 Days

Transient overexpression lysate of membrane-spanning 4-domains, subfamily A, member 4 (MS4A4A), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
LY402965 is the same product as LY429724.