Aldolase C (ALDOC) (C-term) rabbit polyclonal antibody, Ig Fraction
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | ALDOC antibody was raised against kLH conjugated synthetic peptide selected from the C-terminal region of Human ALDOC. Epitope: C-Terminus |
Rabbit Polyclonal Anti-ALDOC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDOC antibody: synthetic peptide directed towards the N terminal of human ALDOC. Synthetic peptide located within the following region: MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE |
Rabbit Polyclonal Anti-ALDOC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDOC antibody: synthetic peptide directed towards the C terminal of human ALDOC. Synthetic peptide located within the following region: CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA |
Germany
Japan
United Kingdom
China
