Alzheimer’s Disease

Jump to Filters
View as table Download
BDNF Rabbit Polyclonal Antibody
TA328615

USD 905.00

2 Weeks

Rabbit Polyclonal Anti-BDNF

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor).
BAX Rabbit Polyclonal Antibody
TA590174

USD 482.00

In Stock

Rabbit Polyclonal Bax Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
BDNF Rabbit Polyclonal Antibody
TA319152

USD 765.00

In Stock

Rabbit polyclonal anti-BDNF antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli.
BAX Rabbit Polyclonal Antibody
TA890001

USD 407.00

In Stock

Rabbit polyclonal BAX Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX.
BAX Rabbit Polyclonal Antibody
TA321642

USD 380.00

4 Weeks

Anti-BAX Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-172 amino acids of human BCL2-associated X protein
BDNF Rabbit Polyclonal Antibody
TA328614

USD 850.00

2 Weeks

Rabbit Polyclonal Anti-proBDNF

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)DEDQKVRPNEENNKDAD, corresponding to amino acid residues 72-88 of human BDNF (precursor). Pro-domain of the BDNF protein.
BDNF Rabbit Polyclonal Antibody
TA346304

USD 539.00

5 Days

Rabbit Polyclonal Anti-BDNF Antibody

Applications IHC, WB
Reactivities Mouse, Human, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
BAX Rabbit Polyclonal Antibody
TA890001S

USD 188.00

In Stock

Rabbit polyclonal BAX Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX.

Special Offer: Get this product for $99/€99. Use code: "Truesample".

BAX Rabbit Polyclonal Antibody
TA312596

USD 380.00

4 Weeks

Rabbit polyclonal anti-BAX antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BAX.
BAX Goat Polyclonal Antibody
AB0164-200

USD 355.00

In Stock

Goat Polyclonal Anti-BAX Antibody

Applications IF, WB
Reactivities Human, Rat, Mouse, Canine, Monkey
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 90 aa to the N-terminus of human BAX produced in E. coli.
BDNF Rabbit Polyclonal Antibody
TA323908

USD 380.00

In Stock

Anti-BDNF Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-247 amino acids of human brain-derived neurotrophic factor
BDNF Rabbit Polyclonal Antibody
TA327032

USD 365.00

3 Weeks

Rabbit anti-BDNF Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BDNF
BAX Rabbit Polyclonal Antibody
TA312600

USD 380.00

In Stock

Rabbit polyclonal anti-Bax antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Bax.
BAX Rabbit Polyclonal Antibody
TA312598

USD 380.00

4 Weeks

Rabbit polyclonal Bax (Ab-167) antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Bax around the phosphorylation site of threonine 167 (F-G-TP-P-T)
BAX Rabbit Polyclonal Antibody
TA325255

USD 380.00

4 Weeks

Rabbit Polyclonal Bax Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Bax.