Assay Kits

Jump to Filters
View as table Download
PCNA Rabbit Polyclonal Antibody
TA590137

USD 482.00

In Stock

Rabbit Polyclonal PCNA Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
HDAC2 Rabbit Polyclonal Antibody
TA590734

USD 482.00

In Stock

Rabbit Polyclonal HDAC2 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
PLK1 Mouse Monoclonal Capture Antibody [Clone ID: OTI8C12]
TA600111

USD 458.00

In Stock

PLK1 mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700111, TA700137, TA700138, TA700139
MCM6 Rabbit Polyclonal Antibody
TA590213

USD 482.00

In Stock

Rabbit Polyclonal MCM6 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
BubR1 (BUB1B) Rabbit Polyclonal Antibody
TA590739

USD 482.00

In Stock

Rabbit Polyclonal BubR1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
DNA PKcs (PRKDC) Mouse Monoclonal Antibody [Clone ID: 3H6]
TA336925

USD 550.00

5 Days

Mouse Monoclonal DNA-PKcs Antibody (3H6)

Applications ELISA, ICC/IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
TA336925 is a replacement of AM06582SU-N.
p18 INK4c (CDKN2C) Rabbit Polyclonal Antibody
TA590417

USD 482.00

In Stock

Rabbit Polyclonal p18 INK4c Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
CDK6 Mouse Monoclonal Antibody [Clone ID: 8H4]
AM31156PU-N

USD 535.00

2 Weeks

CDK6 mouse monoclonal antibody, clone 8H4, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
c-Myc (MYC) Mouse Monoclonal Capture Antibody [Clone ID: OTI3F2]
TA600496

USD 458.00

In Stock

purified MYC mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700496
p53 (TP53) Rabbit Polyclonal Antibody
TA329146

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
E2F1 Rabbit Polyclonal Antibody
TA590609

USD 482.00

In Stock

Rabbit Polyclonal E2F1 Antibody

Applications ELISA, IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
Cyclin A2 (CCNA2) Rabbit Polyclonal Antibody
TA590075

USD 482.00

In Stock

Rabbit Polyclonal Cyclin A2 Antibody

Applications ELISA, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
c-Myc (MYC) Mouse Monoclonal Capture Antibody [Clone ID: OTI1A6]
TA600497

USD 458.00

In Stock

purified MYC mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700497