Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free
| Applications | ELISA, FN, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
STAT1 mouse monoclonal antibody, clone AT1F4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 425.00
2 Weeks
p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
STAT1 mouse monoclonal antibody, clone AT1F4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
