Assay Kits

Jump to Filters
View as table Download
HDAC2 Rabbit Polyclonal Antibody
TA590734

USD 482.00

In Stock

Rabbit Polyclonal HDAC2 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
c-Myc (MYC) Mouse Monoclonal Capture Antibody [Clone ID: OTI3F2]
TA600496

USD 458.00

In Stock

purified MYC mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700496
STAT5A Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI8H1]
TA700171

USD 494.00

In Stock

STAT5A biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600173
p53 (TP53) Rabbit Polyclonal Antibody
TA329146

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
RUNX1 Rabbit Polyclonal Antibody
TA347279

USD 580.00

5 Days

Rabbit Polyclonal AML1-ETO Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AML1-ETO antibody: the AML1-ETO fusion protein using a KLH-conjugated synthetic peptide.
E2F1 Rabbit Polyclonal Antibody
TA590609

USD 482.00

In Stock

Rabbit Polyclonal E2F1 Antibody

Applications ELISA, IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
STAT5A Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI4H1]
TA700170

USD 494.00

2 Weeks

STAT5A biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600170, TA600171, TA600172
STAT5A Mouse Monoclonal Capture Antibody [Clone ID: OTI8H1]
TA600171

USD 458.00

In Stock

STAT5A mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700170
c-Myc (MYC) Mouse Monoclonal Capture Antibody [Clone ID: OTI1A6]
TA600497

USD 458.00

In Stock

purified MYC mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700497
p53 (TP53) Rabbit Polyclonal Antibody
TA329142

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP
STAT5A Mouse Monoclonal Capture Antibody [Clone ID: OTI4H1]
TA600173

USD 458.00

In Stock

STAT5A mouse monoclonal capture antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700171
c-Myc (MYC) Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI1A6]
TA700496

USD 494.00

In Stock

MYC biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600496
c-Myc (MYC) Biotinylated Mouse Monoclonal Detection Antibody (Biotin conjugated) [Clone ID: OTI3F2]
TA700497

USD 494.00

In Stock

MYC biotinylated mouse monoclonal detection antibody, validated for ELISA and Luminex assays

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Biotin
Matched ELISA Pair TA600497
p38 (CRK) Rabbit Polyclonal Antibody
AP06075PU-N

USD 465.00

3 Weeks

p38 (CRK) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TGF beta 1 (TGFB1) Mouse Monoclonal Antibody [Clone ID: 8C4]
DM1050

USD 695.00

In Stock

TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free

Applications ELISA, FN, IHC
Reactivities Human
Conjugation Unconjugated